PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g76690.1.p
Common NameBRADI_1g76690, LOC100834879
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 427aa    MW: 44862.8 Da    PI: 7.6662
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g76690.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.96.1e-10280333558
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       kr +r   NR +A rs +RK  +i eLe+kv+ L++e ++L  +l  l+  +a 
  Bradi1g76690.1.p 280 KRVKRVLANRQSAARSKERKMRYIVELEQKVQMLQTEATTLSAQLTLLQRDSAG 333
                       999*****************************************9999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-17276340IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484278341IPR004827Basic-leucine zipper domain
PfamPF001705.4E-9280332IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10280331No hitNo description
SuperFamilySSF579595.84E-11280330No hitNo description
CDDcd147038.29E-22281332No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDSRAAKLMQ QQGMQPLSLP MATSFATEAA AAKPRAAGLP PTPPFSAAAG GGVQRDVCME  60
DSSSSAAAAL KAAAHRRSRS DVPYGYSPSM ASAMAMGRLQ PKTEWGQPQQ HLVENNGFNG  120
NGNGGDDLFN AYMNLEGLDA LNAAASSSPD SRGSSVKAES SENEGYGSEE GAVRGALWAD  180
GNAGSGSNKR SAAAAGAVGE PAAANVARHA RSLSMDSLMG RLNFASGAGA SASAARAANG  240
GAGGGSVFSL EFGSGEFTPV EMKKIMADER LAEMALADPK RVKRVLANRQ SAARSKERKM  300
RYIVELEQKV QMLQTEATTL SAQLTLLQRD SAGVATQNNE LRFRLQAMEQ QAQLRDALND  360
ALTGEVQRLK IATAEIGVGD SCSSSGMAQQ NQMFQLQQHQ GQATPRPFYQ LQQQQQQHNG  420
NHEPRE*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562153.30.0PREDICTED: transcription factor RF2b-like
TrEMBLI1HA860.0I1HA86_BRADI; Uncharacterized protein
STRINGBRADI1G76690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.37e-52bZIP family protein